Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMBIM1 Rabbit Polyclonal Antibody (Biotin)

TMBIM1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LFG3, RECS1, MST100, PP1201, MSTP100

UniProt

Q969X1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TMBIM1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GYGHPAGYPQPMPPTHPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_071435

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat C4 (Complement Component 4) ELISA Kit
E-EL-R0248-01 24 Tests

Rat C4 (Complement Component 4) ELISA Kit

Sign In for Pricing
View Details
Rat C4 (Complement Component 4) ELISA Kit
E-EL-R0248-02 48 Tests

Rat C4 (Complement Component 4) ELISA Kit

Sign In for Pricing
View Details
Rat C4 (Complement Component 4) ELISA Kit
E-EL-R0248-03 96 Tests

Rat C4 (Complement Component 4) ELISA Kit

Sign In for Pricing
View Details
Protein A Texas Red Colloidal Gold, 1mL 10nm
TGP-01-10 1 mL

Protein A Texas Red Colloidal Gold, 1mL 10nm

Sign In for Pricing
View Details
CD299 (CLEC4M) Mouse Monoclonal Antibody [Clone ID: OTI10C3]
CF810055 100 µg

CD299 (CLEC4M) Mouse Monoclonal Antibody [Clone ID: OTI10C3]

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS634635 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details