Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMBIM1 Rabbit Polyclonal Antibody (HRP)

TMBIM1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LFG3, RECS1, MST100, PP1201, MSTP100

UniProt

Q969X1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TMBIM1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GYGHPAGYPQPMPPTHPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_071435

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HK1 Protein Vector (Mouse) (pPB-C-His)
PV189006 500 ng

HK1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
IFT43 CRISPR Activation Plasmid (h)
sc-407991-ACT 20 µg

IFT43 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Anti-TMPRSS6 Rabbit Polyclonal Antibody
orb2569059 100 µg

Anti-TMPRSS6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sheep Soluble programmed death-1 ELISA Kit
MBS753289-01 48 Well

Sheep Soluble programmed death-1 ELISA Kit

Sign In for Pricing
View Details
Sheep Soluble programmed death-1 ELISA Kit
MBS753289-02 96 Well

Sheep Soluble programmed death-1 ELISA Kit

Sign In for Pricing
View Details
Sheep Soluble programmed death-1 ELISA Kit
MBS753289-03 5x 96 Well

Sheep Soluble programmed death-1 ELISA Kit

Sign In for Pricing
View Details