Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS26 Rabbit Polyclonal Antibody (HRP)

MRPS26 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GI008, MRPS13, RPMS13, MRP-S13, MRP-S26, NY-BR-87, C20orf193, dJ534B8.3

UniProt

Q9BYN8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPS26

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RQALEQARKAEEVQAWAQRKEREVLQLQEEVKNFITRENLEARVEAALDS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_110438

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gcsh 3'UTR GFP Stable Cell Line
TU156982 1.0 mL

Gcsh 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PA2G4P3 Protein Vector (Human) (pPB-N-His)
PV109383 500 ng

PA2G4P3 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Lentiviral mouse Hc shRNA (UAS) - Lentiviral mouse Hc shRNA (UAS, RFP) (100)
GTR15306507 1 Vial

Lentiviral mouse Hc shRNA (UAS) - Lentiviral mouse Hc shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Recombinant Mouse Protein ALEX (Gnas)
MBS1369125-01 0.02 mg (E-Coli)

Recombinant Mouse Protein ALEX (Gnas)

Sign In for Pricing
View Details
Recombinant Mouse Protein ALEX (Gnas)
MBS1369125-02 0.02 mg (Yeast)

Recombinant Mouse Protein ALEX (Gnas)

Sign In for Pricing
View Details
Recombinant Mouse Protein ALEX (Gnas)
MBS1369125-03 0.1 mg (Yeast)

Recombinant Mouse Protein ALEX (Gnas)

Sign In for Pricing
View Details