Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS26 Rabbit Polyclonal Antibody (HRP)

MRPS26 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GI008, MRPS13, RPMS13, MRP-S13, MRP-S26, NY-BR-87, C20orf193, dJ534B8.3

UniProt

Q9BYN8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPS26

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LMAWNQAENRRLHELRIARLRQEEREQEQRQALEQARKAEEVQAWAQRKE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_110438

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LPA2 Rabbit Polyclonal Antibody (RBITC)
orb1063686 100 µL

LPA2 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
Chicken Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4) ELISA Kit
MBS7212255-01 48 Well

Chicken Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4) ELISA Kit

Sign In for Pricing
View Details
Chicken Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4) ELISA Kit
MBS7212255-02 96 Well

Chicken Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4) ELISA Kit

Sign In for Pricing
View Details
Chicken Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4) ELISA Kit
MBS7212255-03 5x 96 Well

Chicken Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4) ELISA Kit

Sign In for Pricing
View Details
Chicken Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4) ELISA Kit
MBS7212255-04 10x 96 Well

Chicken Carcinoembryonic antigen-related cell adhesion molecule 4 (CEACAM4) ELISA Kit

Sign In for Pricing
View Details
Free Thyroxine (FT4) BioAssayTM ELISA Kit (Chicken) discontinued
519248 96 Tests

Free Thyroxine (FT4) BioAssayTM ELISA Kit (Chicken) discontinued

Sign In for Pricing
View Details