Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PYCR3 Rabbit Polyclonal Antibody (Biotin)

PYCR3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PYCRL

UniProt

D3DWK4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PYCRL

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LIRAGKVEAQHILASAPTDRNLCHFQALGCRTTHSNQEVLQSCLLVIFAT

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_075566

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Annexin V/ANXA5 Antibody Picoband®
PB9044 100 µg/Vial

Anti-Annexin V/ANXA5 Antibody Picoband®

Sign In for Pricing
View Details
GOT2 antibody (FITC)
60R-2213 0.1 mg

GOT2 antibody (FITC)

Sign In for Pricing
View Details
Human RAD51 (DNA repair protein RAD51 homolog 1) QuickTest ELISA Kit
MBS7619044-01 48 Well

Human RAD51 (DNA repair protein RAD51 homolog 1) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human RAD51 (DNA repair protein RAD51 homolog 1) QuickTest ELISA Kit
MBS7619044-02 96 Well

Human RAD51 (DNA repair protein RAD51 homolog 1) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human RAD51 (DNA repair protein RAD51 homolog 1) QuickTest ELISA Kit
MBS7619044-03 5x 96 Well

Human RAD51 (DNA repair protein RAD51 homolog 1) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human RAD51 (DNA repair protein RAD51 homolog 1) QuickTest ELISA Kit
MBS7619044-04 10x 96 Well

Human RAD51 (DNA repair protein RAD51 homolog 1) QuickTest ELISA Kit

Sign In for Pricing
View Details