Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AUNIP Rabbit Polyclonal Antibody (Biotin)

AUNIP Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AIBP, C1orf135

UniProt

Q9H7T9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human AUNIP

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RAPSTGIHQRSIASFFTLQPGKTNGSDQKSVSSHTESQINKESKKNATQL

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_076942

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Astl 3'UTR Luciferase Stable Cell Line
TU102236 1.0 mL

Astl 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Fsip1 Rat shRNA Lentiviral Particle (Locus ID 296074)
TL701828V 500 µL Each

Fsip1 Rat shRNA Lentiviral Particle (Locus ID 296074)

Sign In for Pricing
View Details
Hint1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K5027804 1.0 µg DNA

Hint1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Human Hypoxia Inducible Factor 2 Alpha (HIF2a) ELISA Kit
MBS454014-01 48 Tests

Human Hypoxia Inducible Factor 2 Alpha (HIF2a) ELISA Kit

Sign In for Pricing
View Details
Human Hypoxia Inducible Factor 2 Alpha (HIF2a) ELISA Kit
MBS454014-02 96 Tests

Human Hypoxia Inducible Factor 2 Alpha (HIF2a) ELISA Kit

Sign In for Pricing
View Details
Human Hypoxia Inducible Factor 2 Alpha (HIF2a) ELISA Kit
MBS454014-03 5x 96 Tests

Human Hypoxia Inducible Factor 2 Alpha (HIF2a) ELISA Kit

Sign In for Pricing
View Details