Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATA5L1 Rabbit Polyclonal Antibody (Biotin)

SPATA5L1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9BVQ7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SPATA5L1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CDVQERVLSVLLNELDGVGLKTIERRGSKSSQQEFQEVFNRSVMIIAATN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_076968

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CENPH (NM_022909) Human Tagged Lenti ORF Clone
RC204531L1 10 µg

CENPH (NM_022909) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RPS6KC1 sgRNA CRISPR Lentivector set (Human)
K2014901 3x 1.0 µg

RPS6KC1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
AP2S1 Recombinant Antibody, APC-Cy7 Conjugated
bsm-61180R-APC-Cy7 100 µL

AP2S1 Recombinant Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Phospho-FAK (Ser732) Polyclonal Antibody, PE Conjugated
bs-1642R-PE-TR 20 µL

Phospho-FAK (Ser732) Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
LCLT1, CT (LCLAT1, AGPAT8, ALCAT1, LYCAT, Lysocardiolipin acyltransferase 1, 1-acylglycerol-3-phosphate O-acyltransferase 8, Acyl-CoA:lysocardiolipin acyltransferase 1) (APC)
MBS6315482-01 0.2 mL

LCLT1, CT (LCLAT1, AGPAT8, ALCAT1, LYCAT, Lysocardiolipin acyltransferase 1, 1-acylglycerol-3-phosphate O-acyltransferase 8, Acyl-CoA:lysocardiolipin acyltransferase 1) (APC)

Sign In for Pricing
View Details
LCLT1, CT (LCLAT1, AGPAT8, ALCAT1, LYCAT, Lysocardiolipin acyltransferase 1, 1-acylglycerol-3-phosphate O-acyltransferase 8, Acyl-CoA:lysocardiolipin acyltransferase 1) (APC)
MBS6315482-02 5x 0.2 mL

LCLT1, CT (LCLAT1, AGPAT8, ALCAT1, LYCAT, Lysocardiolipin acyltransferase 1, 1-acylglycerol-3-phosphate O-acyltransferase 8, Acyl-CoA:lysocardiolipin acyltransferase 1) (APC)

Sign In for Pricing
View Details