Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAPPC6A Rabbit Polyclonal Antibody (Biotin)

TRAPPC6A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TRS33

UniProt

O75865

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRAPPC6A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HDPDPGPGVSAGLRGEEAGATKGQKMSLSVLEGMGFRVGQALGERLPRET

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_077013

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CC2D1A Antibody [FITC]
NB500-255F 0.1 mL

Rabbit Polyclonal CC2D1A Antibody [FITC]

Sign In for Pricing
View Details
LILRB4 Protein, Human (His-Flag) _a
HY-P7S1711A 1 Each

LILRB4 Protein, Human (His-Flag) _a

Sign In for Pricing
View Details
EIF1B Antibody Blocking Peptide
orb1512263 500 µg

EIF1B Antibody Blocking Peptide

Sign In for Pricing
View Details
Chicken ATPase WRNIP1 (WRNIP1) ELISA Kit
GTR10327650 96 Well

Chicken ATPase WRNIP1 (WRNIP1) ELISA Kit

Sign In for Pricing
View Details
SCARB1, NT (SCARB1, CD36L1, CLA1, Scavenger receptor class B member 1, CD36 and LIMPII analogous 1, CD36 antigen-like 1, Collagen type I receptor, thrombospondin receptor-like 1, SR-BI, CD36) (APC) discontinued
041450-APC 200 µL

SCARB1, NT (SCARB1, CD36L1, CLA1, Scavenger receptor class B member 1, CD36 and LIMPII analogous 1, CD36 antigen-like 1, Collagen type I receptor, thrombospondin receptor-like 1, SR-BI, CD36) (APC) discontinued

Sign In for Pricing
View Details
EID2, CT (EID2, CRI2, EP300-interacting inhibitor of differentiation 2, CREBBP/EP300 inhibitor 2, EID-1-like inhibitor of differentiation 2) (MaxLight 650)
MBS6294805-01 0.1 mL

EID2, CT (EID2, CRI2, EP300-interacting inhibitor of differentiation 2, CREBBP/EP300 inhibitor 2, EID-1-like inhibitor of differentiation 2) (MaxLight 650)

Sign In for Pricing
View Details