Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAPPC6A Rabbit Polyclonal Antibody (HRP)

TRAPPC6A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TRS33

UniProt

O75865

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TRAPPC6A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HDPDPGPGVSAGLRGEEAGATKGQKMSLSVLEGMGFRVGQALGERLPRET

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_077013

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Scissors Mayos 188mm Curved
INS4857 1 Each

Scissors Mayos 188mm Curved

Sign In for Pricing
View Details
Recombinant Human Activator of 90 kDa heat shock protein ATPase homolog 1 (AHSA1)
CSB-EP001483HU-01 20 µg

Recombinant Human Activator of 90 kDa heat shock protein ATPase homolog 1 (AHSA1)

Sign In for Pricing
View Details
Recombinant Human Activator of 90 kDa heat shock protein ATPase homolog 1 (AHSA1)
CSB-EP001483HU-02 100 µg

Recombinant Human Activator of 90 kDa heat shock protein ATPase homolog 1 (AHSA1)

Sign In for Pricing
View Details
Recombinant Human Activator of 90 kDa heat shock protein ATPase homolog 1 (AHSA1)
CSB-EP001483HU-03 1 mg

Recombinant Human Activator of 90 kDa heat shock protein ATPase homolog 1 (AHSA1)

Sign In for Pricing
View Details
Recombinant Human Ankyrin repeat and SOCS box protein 14 (ASB14)
MBS1129617-01 0.02 mg (E-Coli)

Recombinant Human Ankyrin repeat and SOCS box protein 14 (ASB14)

Sign In for Pricing
View Details
Recombinant Human Ankyrin repeat and SOCS box protein 14 (ASB14)
MBS1129617-02 0.02 mg (Yeast)

Recombinant Human Ankyrin repeat and SOCS box protein 14 (ASB14)

Sign In for Pricing
View Details