Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C19ORF57 Rabbit Polyclonal Antibody (HRP)

C19ORF57 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MEIOK21, C19orf57

UniProt

Q0VDD7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human C19ORF57

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VPSTQQHGEEPGKAVSSSPDEETGSPCRLLRQPEKEPAPLPPSQNSFGRF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_077299.3

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFIIS (TCEA2) (NM_003195) Human Tagged ORF Clone Lentiviral Particle
RC222661L4V 200 µL

TFIIS (TCEA2) (NM_003195) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Dexi Mouse shRNA Lentiviral Particle (Locus ID 58239)
TL517393V 500 µL Each

Dexi Mouse shRNA Lentiviral Particle (Locus ID 58239)

Sign In for Pricing
View Details
FASTG-PAG-BC, SDS, 4-12% 1.0mm 10well
KG4510-BC 10/PK

FASTG-PAG-BC, SDS, 4-12% 1.0mm 10well

Sign In for Pricing
View Details
MDP1 ORF Vector (Human) (pORF)
28273011 1.0 µg DNA

MDP1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Monoclonal Dihydrofolate Reductase/DHFR Antibody (OTI6G7) [DyLight 350]
NBP2-70569UV 0.1 mL

Mouse Monoclonal Dihydrofolate Reductase/DHFR Antibody (OTI6G7) [DyLight 350]

Sign In for Pricing
View Details
Rabbit Anti CD74 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot)
IRBAMLCD74AP879120UL 1 Each

Rabbit Anti CD74 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot)

Sign In for Pricing
View Details