Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNJL Rabbit Polyclonal Antibody (HRP)

CCNJL Rabbit Polyclonal Antibody (HRP)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCNJL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GQPATTLAQFQTPVQDLCLAYRDSLQAHRSGSLLSGSTGSSLHTPYQPLQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_078841

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bis (tri-o-tolylphosphine) palladium (II) Dichloride
FB60966-01 1000 mg

Bis (tri-o-tolylphosphine) palladium (II) Dichloride

Sign In for Pricing
View Details
Bis (tri-o-tolylphosphine) palladium (II) Dichloride
FB60966-02 2000 mg

Bis (tri-o-tolylphosphine) palladium (II) Dichloride

Sign In for Pricing
View Details
Bis (tri-o-tolylphosphine) palladium (II) Dichloride
FB60966-03 5000 mg

Bis (tri-o-tolylphosphine) palladium (II) Dichloride

Sign In for Pricing
View Details
INCENP Recombinant Protein Antigen
NBP2-57266PEP 100 µL

INCENP Recombinant Protein Antigen

Sign In for Pricing
View Details
2-Mercaptopyridine N-oxide
TRC-M218756-1G 1 g

2-Mercaptopyridine N-oxide

Sign In for Pricing
View Details
Mouse Monoclonal TNF RII/TNFRSF1B Antibody (22221) [Janelia Fluor 585]
FAB226JF585 0.1 mL

Mouse Monoclonal TNF RII/TNFRSF1B Antibody (22221) [Janelia Fluor 585]

Sign In for Pricing
View Details