Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDNF Rabbit Polyclonal Antibody (Biotin)

NDNF Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HH25, NORD, C4orf31

UniProt

Q8TB73

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NDNF

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LEWKLSLQELPEDRSGEGSGDLEPLEQQKQQIINEEGTELFSYKGNDVEY

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_078850

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA Polymerase Theta Activity Assay Kit
362101-96 96 Reactions

DNA Polymerase Theta Activity Assay Kit

Sign In for Pricing
View Details
Anti-Mouse TGFB1/TGF-beta-1 Polyclonal Antibody
PTX19973 100 µg

Anti-Mouse TGFB1/TGF-beta-1 Polyclonal Antibody

Sign In for Pricing
View Details
TCIRG1 (T-cell Immune Regulator 1, ATP6N1C, ATP6V0A3, V-type Proton ATPase 116kD Subunit a Isoform 3, V-ATPase 116kD Isoform a3, Osteoclastic Proton Pump 116kD Subunit, OC-116kD, OC116, T-cell Immune Response cDNA7 Protein, TIRC7, Vacuolar Proton Transloc
MBS6214364-01 0.1 mL

TCIRG1 (T-cell Immune Regulator 1, ATP6N1C, ATP6V0A3, V-type Proton ATPase 116kD Subunit a Isoform 3, V-ATPase 116kD Isoform a3, Osteoclastic Proton Pump 116kD Subunit, OC-116kD, OC116, T-cell Immune Response cDNA7 Protein, TIRC7, Vacuolar Proton Transloc

Sign In for Pricing
View Details
TCIRG1 (T-cell Immune Regulator 1, ATP6N1C, ATP6V0A3, V-type Proton ATPase 116kD Subunit a Isoform 3, V-ATPase 116kD Isoform a3, Osteoclastic Proton Pump 116kD Subunit, OC-116kD, OC116, T-cell Immune Response cDNA7 Protein, TIRC7, Vacuolar Proton Transloc
MBS6214364-02 5x 0.1 mL

TCIRG1 (T-cell Immune Regulator 1, ATP6N1C, ATP6V0A3, V-type Proton ATPase 116kD Subunit a Isoform 3, V-ATPase 116kD Isoform a3, Osteoclastic Proton Pump 116kD Subunit, OC-116kD, OC116, T-cell Immune Response cDNA7 Protein, TIRC7, Vacuolar Proton Transloc

Sign In for Pricing
View Details
2- (3,4-Dihydro-2H-1,5-benzodioxepin-7-yl) ethan-1-amine
JEA50657-01 100 mg

2- (3,4-Dihydro-2H-1,5-benzodioxepin-7-yl) ethan-1-amine

Sign In for Pricing
View Details
2- (3,4-Dihydro-2H-1,5-benzodioxepin-7-yl) ethan-1-amine
JEA50657-02 1 g

2- (3,4-Dihydro-2H-1,5-benzodioxepin-7-yl) ethan-1-amine

Sign In for Pricing
View Details