Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDNF Rabbit Polyclonal Antibody (HRP)

NDNF Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HH25, NORD, C4orf31

UniProt

Q8TB73

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NDNF

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LEWKLSLQELPEDRSGEGSGDLEPLEQQKQQIINEEGTELFSYKGNDVEY

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_078850

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Barcoded Reusable Goniometer Base B1
HT-GB-B1-R-10 10 PCS

Barcoded Reusable Goniometer Base B1

Sign In for Pricing
View Details
Methysergide Maleate (5-HT Serotonin Receptor Antagonsit, Methysergide Maleate, UML-491)
217546 10 mg

Methysergide Maleate (5-HT Serotonin Receptor Antagonsit, Methysergide Maleate, UML-491)

Sign In for Pricing
View Details
Rat Interleukin Receptor Associated Kinase IRAK ELISA Kit
BG-RAT11407 1 Each

Rat Interleukin Receptor Associated Kinase IRAK ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse Transient receptor potential cation channel subfamily V member 6 (Trpv6) -VLPs
CSB-MP852782MO-01 20 µg

Recombinant Mouse Transient receptor potential cation channel subfamily V member 6 (Trpv6) -VLPs

Sign In for Pricing
View Details
Recombinant Mouse Transient receptor potential cation channel subfamily V member 6 (Trpv6) -VLPs
CSB-MP852782MO-02 100 µg

Recombinant Mouse Transient receptor potential cation channel subfamily V member 6 (Trpv6) -VLPs

Sign In for Pricing
View Details
Recombinant Mouse Transient receptor potential cation channel subfamily V member 6 (Trpv6) -VLPs
CSB-MP852782MO-03 1 mg

Recombinant Mouse Transient receptor potential cation channel subfamily V member 6 (Trpv6) -VLPs

Sign In for Pricing
View Details