Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC121 Rabbit Polyclonal Antibody (Biotin)

CCDC121 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

J3KQZ8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CCDC121

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QLLEESRELHREKLLVQAENRFFLEYLTNKTEEYTEQPEKVWNSYLQKSG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Yeast

Tested Applications

WB

NCBI Accession Number

NP_001136155

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Complement C1q tumor necrosis factor related protein 5, C1qtnf5/Ctrp5 ELISA Kit
MBS9305705-01 48 Well

Human Complement C1q tumor necrosis factor related protein 5, C1qtnf5/Ctrp5 ELISA Kit

Sign In for Pricing
View Details
Human Complement C1q tumor necrosis factor related protein 5, C1qtnf5/Ctrp5 ELISA Kit
MBS9305705-02 96 Well

Human Complement C1q tumor necrosis factor related protein 5, C1qtnf5/Ctrp5 ELISA Kit

Sign In for Pricing
View Details
Human Complement C1q tumor necrosis factor related protein 5, C1qtnf5/Ctrp5 ELISA Kit
MBS9305705-03 5x 96 Well

Human Complement C1q tumor necrosis factor related protein 5, C1qtnf5/Ctrp5 ELISA Kit

Sign In for Pricing
View Details
Human Complement C1q tumor necrosis factor related protein 5, C1qtnf5/Ctrp5 ELISA Kit
MBS9305705-04 10x 96 Well

Human Complement C1q tumor necrosis factor related protein 5, C1qtnf5/Ctrp5 ELISA Kit

Sign In for Pricing
View Details
MMP11 Antibody
orb1284507 100 µL

MMP11 Antibody

Sign In for Pricing
View Details
Human ALX1 Recombinant Protein (N-His)
HD673012-01 50 µg

Human ALX1 Recombinant Protein (N-His)

Sign In for Pricing
View Details