Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC121 Rabbit Polyclonal Antibody (HRP)

CCDC121 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

J3KQZ8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CCDC121

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QLLEESRELHREKLLVQAENRFFLEYLTNKTEEYTEQPEKVWNSYLQKSG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Yeast

Tested Applications

WB

NCBI Accession Number

NP_001136155

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Macrophage inflammatory protein -5 ELISA Kit
MBS731109-01 48 Well

Mouse Macrophage inflammatory protein -5 ELISA Kit

Sign In for Pricing
View Details
Mouse Macrophage inflammatory protein -5 ELISA Kit
MBS731109-02 96 Well

Mouse Macrophage inflammatory protein -5 ELISA Kit

Sign In for Pricing
View Details
Mouse Macrophage inflammatory protein -5 ELISA Kit
MBS731109-03 5x 96 Well

Mouse Macrophage inflammatory protein -5 ELISA Kit

Sign In for Pricing
View Details
Mouse Macrophage inflammatory protein -5 ELISA Kit
MBS731109-04 10x 96 Well

Mouse Macrophage inflammatory protein -5 ELISA Kit

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Parathyroid Hormone (PTH)
MBS2118444-01 0.1 mL

PE-Linked Polyclonal Antibody to Parathyroid Hormone (PTH)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Parathyroid Hormone (PTH)
MBS2118444-02 0.2 mL

PE-Linked Polyclonal Antibody to Parathyroid Hormone (PTH)

Sign In for Pricing
View Details