Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC121 Rabbit Polyclonal Antibody (FITC)

CCDC121 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

J3KQZ8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CCDC121

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ENRFFLEYLTNKTEEYTEQPEKVWNSYLQKSGEIERRRQESASRYAEQIS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_001136155

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF280B, NT (ZNF280B, SUHW2, ZNF279, ZNF632, Zinc finger protein 280B, 5'OY11.1, Suppressor of hairy wing homolog 2, Zinc finger protein 279, Zinc finger protein 632) (AP) discontinued
044175-AP 200 µL

ZNF280B, NT (ZNF280B, SUHW2, ZNF279, ZNF632, Zinc finger protein 280B, 5'OY11.1, Suppressor of hairy wing homolog 2, Zinc finger protein 279, Zinc finger protein 632) (AP) discontinued

Sign In for Pricing
View Details
Lentiviral human PARP11 shRNA (UAS) - Lentiviral human PARP11 shRNA (UAS, GFP) (25)
GTR15108068 1 Vial

Lentiviral human PARP11 shRNA (UAS) - Lentiviral human PARP11 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Phospho-Tau (Ser396) Rabbit Polyclonal Antibody (PE-Cy5)
orb886199 100 µL

Phospho-Tau (Ser396) Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
SERPINA3 Rabbit Polyclonal Antibody (FITC)
orb2110182 100 µL

SERPINA3 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
CZC-25146 hydrochloride
MBS3609909-01 5 mg

CZC-25146 hydrochloride

Sign In for Pricing
View Details
CZC-25146 hydrochloride
MBS3609909-02 10 mg

CZC-25146 hydrochloride

Sign In for Pricing
View Details