Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD55 Rabbit Polyclonal Antibody (HRP)

ANKRD55 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q3KP44

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ANKRD55

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSQESRTEPTRPPPSQSSRPQKKERRFNVLNQIFCKNKKEEQRAHQKDPS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_078945

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PON 1 Antibody
E553006-15-PU 100 µg

PON 1 Antibody

Sign In for Pricing
View Details
Transcriptional Regulating Factor 1 (TRERF1), Recombinant, Human, His-Tag
049694-01 10 µg

Transcriptional Regulating Factor 1 (TRERF1), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Transcriptional Regulating Factor 1 (TRERF1), Recombinant, Human, His-Tag
049694-02 50 µg

Transcriptional Regulating Factor 1 (TRERF1), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Transcriptional Regulating Factor 1 (TRERF1), Recombinant, Human, His-Tag
049694-03 100 µg

Transcriptional Regulating Factor 1 (TRERF1), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Transcriptional Regulating Factor 1 (TRERF1), Recombinant, Human, His-Tag
049694-04 200 µg

Transcriptional Regulating Factor 1 (TRERF1), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Rabbit Polyclonal Semaphorin 4G Antibody
NBP1-82171 0.1 mL

Rabbit Polyclonal Semaphorin 4G Antibody

Sign In for Pricing
View Details