Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tbc1d17 Rabbit Polyclonal Antibody (HRP)

Tbc1d17 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BC017607

UniProt

Q8BYH7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Tbc1d17

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FCGFMELVHGNFEESQETMKRQLGQLLLLLRVLDQPLCDFLDSQDSGSLC

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001036120

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Transmembrane Protease, Serine 4 (TMPRSS4) ELISA Kit
MBS2705909-01 24 Strip Well

Human Transmembrane Protease, Serine 4 (TMPRSS4) ELISA Kit

Sign In for Pricing
View Details
Human Transmembrane Protease, Serine 4 (TMPRSS4) ELISA Kit
MBS2705909-02 48 Well

Human Transmembrane Protease, Serine 4 (TMPRSS4) ELISA Kit

Sign In for Pricing
View Details
Human Transmembrane Protease, Serine 4 (TMPRSS4) ELISA Kit
MBS2705909-03 96 Well

Human Transmembrane Protease, Serine 4 (TMPRSS4) ELISA Kit

Sign In for Pricing
View Details
Human Transmembrane Protease, Serine 4 (TMPRSS4) ELISA Kit
MBS2705909-04 5x 96 Well

Human Transmembrane Protease, Serine 4 (TMPRSS4) ELISA Kit

Sign In for Pricing
View Details
Human Transmembrane Protease, Serine 4 (TMPRSS4) ELISA Kit
MBS2705909-05 10x 96 Well

Human Transmembrane Protease, Serine 4 (TMPRSS4) ELISA Kit

Sign In for Pricing
View Details
Anti-PDGF AA/PDGFA Antibody Picoband® Fluoro647 Conjugated
A02257-1-Fluoro647 100 µg/Vial

Anti-PDGF AA/PDGFA Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details