Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADGB Rabbit Polyclonal Antibody (HRP)

ADGB Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CAPN16, C6orf103

UniProt

Q8N7X0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ADGB

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SESGGVSSPGKEEREQSTRKENIQTGPRTRSPTILETSPRLIRKALEFMD

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_078970

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPPA5 CRISPR Knock Out 293T Cell Line (Human)
18554141 1x 10^6 Cells / 1.0 mL

DPPA5 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
RPA43, CT (TWISTNB, DNA-directed RNA polymerase I subunit RPA43, Twist neighbor protein) (MaxLight 490) discontinued
041176-ML490 100 µL

RPA43, CT (TWISTNB, DNA-directed RNA polymerase I subunit RPA43, Twist neighbor protein) (MaxLight 490) discontinued

Sign In for Pricing
View Details
N-Nitroso Mirabegron Impurity 26
CS-O-44032 1 Each

N-Nitroso Mirabegron Impurity 26

Sign In for Pricing
View Details
NPDC1 (NM_015392) Human Over-expression Lysate
LS056654-100ug 100 µg

NPDC1 (NM_015392) Human Over-expression Lysate

Sign In for Pricing
View Details
FOXR2 Rabbit Polyclonal Antibody (Cy7)
orb1066732 100 µL

FOXR2 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
TXNDC12 Rabbit Polyclonal Antibody
E10G03016 100 µL

TXNDC12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details