Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADGB Rabbit Polyclonal Antibody (HRP)

ADGB Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CAPN16, C6orf103

UniProt

Q8N7X0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ADGB

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SESGGVSSPGKEEREQSTRKENIQTGPRTRSPTILETSPRLIRKALEFMD

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_078970

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mrpl15 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6131305 3x 1.0 µg

Mrpl15 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Recombinant Mink astrovirus 1 Non-structural polyprotein 1AB (ORF1)
MBS7025176-01 0.02 mg

Recombinant Mink astrovirus 1 Non-structural polyprotein 1AB (ORF1)

Sign In for Pricing
View Details
Recombinant Mink astrovirus 1 Non-structural polyprotein 1AB (ORF1)
MBS7025176-02 0.1 mg

Recombinant Mink astrovirus 1 Non-structural polyprotein 1AB (ORF1)

Sign In for Pricing
View Details
Recombinant Mink astrovirus 1 Non-structural polyprotein 1AB (ORF1)
MBS7025176-03 5x 0.1 mg

Recombinant Mink astrovirus 1 Non-structural polyprotein 1AB (ORF1)

Sign In for Pricing
View Details
NPPB Antibody (Biotin)
orb238615-01 50 µg

NPPB Antibody (Biotin)

Sign In for Pricing
View Details
NPPB Antibody (Biotin)
orb238615-02 100 µg

NPPB Antibody (Biotin)

Sign In for Pricing
View Details