Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAMKMT Rabbit Polyclonal Antibody (HRP)

CAMKMT Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Cam, KMT, CLNMT, C2orf34, CaM KMT

UniProt

Q7Z624

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CAMKMT

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QFCNLAEKAGFCIQRHENYDEHISNFHSKLKKENPDIYEENLHYPLLLIL

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079042

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Triprolidine N-Oxide Hemimaleate
TRC-T242160-50MG 50 mg

Triprolidine N-Oxide Hemimaleate

Sign In for Pricing
View Details
SNX11 (NM_013323) Human Recombinant Protein
TP310611 20 µg

SNX11 (NM_013323) Human Recombinant Protein

Sign In for Pricing
View Details
SBFI K+ Salt - green fluorescent sodium indicator
2022B 1 mg

SBFI K+ Salt - green fluorescent sodium indicator

Sign In for Pricing
View Details
Mouse IL-2 (Interleukin 2) ELISA Kit
E-EL-M0042-01 24 Tests

Mouse IL-2 (Interleukin 2) ELISA Kit

Sign In for Pricing
View Details
Mouse IL-2 (Interleukin 2) ELISA Kit
E-EL-M0042-02 48 Tests

Mouse IL-2 (Interleukin 2) ELISA Kit

Sign In for Pricing
View Details
Mouse IL-2 (Interleukin 2) ELISA Kit
E-EL-M0042-03 96 Tests

Mouse IL-2 (Interleukin 2) ELISA Kit

Sign In for Pricing
View Details