Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

QSER1 Rabbit Polyclonal Antibody (Biotin)

QSER1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q2KHR3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human QSER1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LNLHLDQSFKNALESFPELTIITRDSKAKSGGTAISKIKMNGKAYNKKTL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

168kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc7a11 Mouse shRNA Plasmid (Locus ID 26570)
TL515040 1 Kit

Slc7a11 Mouse shRNA Plasmid (Locus ID 26570)

Sign In for Pricing
View Details
Lentiviral human PROSER3 shRNA (UAS) - Lentiviral human PROSER3 shRNA (UAS, RFP) plasmid
GTR15347272 1 Vial

Lentiviral human PROSER3 shRNA (UAS) - Lentiviral human PROSER3 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Stard5 (NM_023377) Mouse Untagged Clone
MC204831 10 µg

Stard5 (NM_023377) Mouse Untagged Clone

Sign In for Pricing
View Details
Rabbit Polyclonal GLUT9 Antibody [Dylight 755]
NBP1-06565IR 0.1 mL

Rabbit Polyclonal GLUT9 Antibody [Dylight 755]

Sign In for Pricing
View Details
LMAN2L Recombinant Protein
92-384 0.05 mg

LMAN2L Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human Cytochrome P450 1A2 Protein - (Dry Ice)
H00001544-Q01-10ug 10 µg

Recombinant Human Cytochrome P450 1A2 Protein - (Dry Ice)

Sign In for Pricing
View Details