Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

QSER1 Rabbit Polyclonal Antibody (FITC)

QSER1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q2KHR3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human QSER1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LNLHLDQSFKNALESFPELTIITRDSKAKSGGTAISKIKMNGKAYNKKTL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

168kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fresolimumab (TGFB, TGF beta)
591874 100 µg

Fresolimumab (TGFB, TGF beta)

Sign In for Pricing
View Details
FOXO1, Phosphorylated (S319) Forkhead Box Protein O1, Forkhead Box Protein O1A, Forkhead In Rhabdomyosarcoma, FKH1, FKHR, FOXO1A) (FITC)
MBS6417611-01 0.1 mL

FOXO1, Phosphorylated (S319) Forkhead Box Protein O1, Forkhead Box Protein O1A, Forkhead In Rhabdomyosarcoma, FKH1, FKHR, FOXO1A) (FITC)

Sign In for Pricing
View Details
FOXO1, Phosphorylated (S319) Forkhead Box Protein O1, Forkhead Box Protein O1A, Forkhead In Rhabdomyosarcoma, FKH1, FKHR, FOXO1A) (FITC)
MBS6417611-02 5x 0.1 mL

FOXO1, Phosphorylated (S319) Forkhead Box Protein O1, Forkhead Box Protein O1A, Forkhead In Rhabdomyosarcoma, FKH1, FKHR, FOXO1A) (FITC)

Sign In for Pricing
View Details
Lentiviral mouse Slc22a28 shRNA (UAS) - Lentiviral mouse Slc22a28 shRNA (UAS) plasmid
GTR15231967 1 Vial

Lentiviral mouse Slc22a28 shRNA (UAS) - Lentiviral mouse Slc22a28 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Phospho-EGFR (Ser1045) Rabbit Polyclonal Antibody (BF750)
orb1574130 100 µL

Phospho-EGFR (Ser1045) Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Fetoprotein, Alpha (AFP, Alpha1-fetoprotein, Alpha-fetoglobulin, Alpha-fetoprotein precursor, FETA, HPAFP) (PE) discontinued
F0060-PE 100 µL

Fetoprotein, Alpha (AFP, Alpha1-fetoprotein, Alpha-fetoglobulin, Alpha-fetoprotein precursor, FETA, HPAFP) (PE) discontinued

Sign In for Pricing
View Details