Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

QSER1 Rabbit Polyclonal Antibody (HRP)

QSER1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q2KHR3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human QSER1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LNLHLDQSFKNALESFPELTIITRDSKAKSGGTAISKIKMNGKAYNKKTL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

168kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LHB ELISA Kit (Human) : 96 Wells (OKEH00839)
OKEH00839 96 Well

LHB ELISA Kit (Human) : 96 Wells (OKEH00839)

Sign In for Pricing
View Details
ZBTB7B Peptide
DF15722-BP 1 mg

ZBTB7B Peptide

Sign In for Pricing
View Details
NDUFB1 Rabbit mAb
MBS4753124-01 0.1 mL

NDUFB1 Rabbit mAb

Sign In for Pricing
View Details
NDUFB1 Rabbit mAb
MBS4753124-02 5x 0.1 mL

NDUFB1 Rabbit mAb

Sign In for Pricing
View Details
hsa-mir-92b RT-PCR Detection Kit
abx096074-01 50 Reactions

hsa-mir-92b RT-PCR Detection Kit

Sign In for Pricing
View Details
hsa-mir-92b RT-PCR Detection Kit
abx096074-02 100 Reactions

hsa-mir-92b RT-PCR Detection Kit

Sign In for Pricing
View Details