Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAB21L4 Rabbit Polyclonal Antibody (HRP)

MAB21L4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C2orf54

UniProt

Q08AI8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human C2orf54

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LKALLQLPASDPTYWATAYFDVLLDKFQVFNIQDKDRISAMQSIFQKTRT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001078906

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hydralazine hydrochloride 1g
A10455-1000 1000 mg

Hydralazine hydrochloride 1g

Sign In for Pricing
View Details
PKM2 Mouse Polyclonal Antibody (AP)
orb894237 100 µL

PKM2 Mouse Polyclonal Antibody (AP)

Sign In for Pricing
View Details
LIVIN (Baculoviral IAP Repeat-containing Protein 7, Kidney Inhibitor of Apoptosis Protein, KIAP, ML-IAP, RING Finger Protein 50, Melanoma Inhibitor of Apoptosis Protein, BIRC7, KIAP, MLIAP, RNF50, UNQ5800/PRO19607/PRO21344) (Biotin)
129126-Biotin 100 µL

LIVIN (Baculoviral IAP Repeat-containing Protein 7, Kidney Inhibitor of Apoptosis Protein, KIAP, ML-IAP, RING Finger Protein 50, Melanoma Inhibitor of Apoptosis Protein, BIRC7, KIAP, MLIAP, RNF50, UNQ5800/PRO19607/PRO21344) (Biotin)

Sign In for Pricing
View Details
Human ENPP3 siRNA
abx901730-01 15 nmol

Human ENPP3 siRNA

Sign In for Pricing
View Details
Human ENPP3 siRNA
abx901730-02 30 nmol

Human ENPP3 siRNA

Sign In for Pricing
View Details
Lentiviral human PAK2 sgRNA gene knockout kit - Lentiviral human PAK2 sgRNA gene knockout kit (25)
GTR15387576 1 Vial

Lentiviral human PAK2 sgRNA gene knockout kit - Lentiviral human PAK2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details