Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35E1 Rabbit Polyclonal Antibody (FITC)

SLC35E1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q96K37

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SLC35E1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MMTAILGVFLYNKTKYDANQQARKHLLPVTTADLSSKERHRSPLEKPHNG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_079157

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Coprinopsis cinerea Mitochondrial outer membrane protein IML2 (IML2)
MBS7017458-01 0.02 mg

Recombinant Coprinopsis cinerea Mitochondrial outer membrane protein IML2 (IML2)

Sign In for Pricing
View Details
Recombinant Coprinopsis cinerea Mitochondrial outer membrane protein IML2 (IML2)
MBS7017458-02 0.1 mg

Recombinant Coprinopsis cinerea Mitochondrial outer membrane protein IML2 (IML2)

Sign In for Pricing
View Details
Recombinant Coprinopsis cinerea Mitochondrial outer membrane protein IML2 (IML2)
MBS7017458-03 5x 0.1 mg

Recombinant Coprinopsis cinerea Mitochondrial outer membrane protein IML2 (IML2)

Sign In for Pricing
View Details
BAG3 Rabbit pAb, Pacific Blue conjugated
orb2827848 100 µL

BAG3 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Caspase 10 (CASP10) (NM_032976) Human Tagged ORF Clone
RC232351 10 µg

Caspase 10 (CASP10) (NM_032976) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human FBXO25 Knockout A549 cell line
GTR15411005 1 Vial

Human FBXO25 Knockout A549 cell line

Sign In for Pricing
View Details