Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35E1 Rabbit Polyclonal Antibody (Biotin)

SLC35E1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q96K37

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SLC35E1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MTAILGVFLYNKTKYDANQQARKHLLPVTTADLSSKERHRSPLEKPHNGL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_079157

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-LTBR Antibody Picoband®, Cy3 Conjugate
A00942-2-Cy3 100 µg/Vial

Anti-LTBR Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
MODIfinder Real-Time PCR MultiSCREEN 3-plex kit for the detection of GM markers pat/bar/cry1Ab
PGE51A-50 50 Tests

MODIfinder Real-Time PCR MultiSCREEN 3-plex kit for the detection of GM markers pat/bar/cry1Ab

Sign In for Pricing
View Details
Mouse Regenerating Islet Derived Protein 1 Beta (REG1b) ELISA Kit
orb780762-01 48 Tests

Mouse Regenerating Islet Derived Protein 1 Beta (REG1b) ELISA Kit

Sign In for Pricing
View Details
Mouse Regenerating Islet Derived Protein 1 Beta (REG1b) ELISA Kit
orb780762-02 96 Tests

Mouse Regenerating Islet Derived Protein 1 Beta (REG1b) ELISA Kit

Sign In for Pricing
View Details
STRADA (LYK5, STE20-related Kinase Adapter Protein alpha, STRAD alpha, STE20-related Adapter Protein, Serologically Defined Breast Cancer Antigen NY-BR-96, STRAD, FLJ90524) (AP) discontinued
129259-AP 100 µL

STRADA (LYK5, STE20-related Kinase Adapter Protein alpha, STRAD alpha, STE20-related Adapter Protein, Serologically Defined Breast Cancer Antigen NY-BR-96, STRAD, FLJ90524) (AP) discontinued

Sign In for Pricing
View Details
Rabbit Anti MAT2B Polyclonal Antigen affinity Purified (PBS with 0.05% NaN3 and 40% Glycerol, pH7.4) (Western Blot,ELISA) 120ul
IRBAMLMAT2BAAP357120UL 120 µL

Rabbit Anti MAT2B Polyclonal Antigen affinity Purified (PBS with 0.05% NaN3 and 40% Glycerol, pH7.4) (Western Blot,ELISA) 120ul

Sign In for Pricing
View Details