Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35E1 Rabbit Polyclonal Antibody (FITC)

SLC35E1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q96K37

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SLC35E1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MTAILGVFLYNKTKYDANQQARKHLLPVTTADLSSKERHRSPLEKPHNGL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_079157

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmco5 ORF Vector (Mouse) (pORF)
ORF059711 1.0 µg DNA

Tmco5 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Mouse Lrrc3c Pre-designed siRNA Set B
SI107850B 1 Each

Mouse Lrrc3c Pre-designed siRNA Set B

Sign In for Pricing
View Details
HPN (TMPRSS1, Serine Protease Hepsin, Transmembrane Protease Serine 1, Serine Protease Hepsin Non-catalytic Chain, Serine Protease Hepsin Catalytic Chain) (MaxLight 650)
MBS6222632-01 0.1 mL

HPN (TMPRSS1, Serine Protease Hepsin, Transmembrane Protease Serine 1, Serine Protease Hepsin Non-catalytic Chain, Serine Protease Hepsin Catalytic Chain) (MaxLight 650)

Sign In for Pricing
View Details
HPN (TMPRSS1, Serine Protease Hepsin, Transmembrane Protease Serine 1, Serine Protease Hepsin Non-catalytic Chain, Serine Protease Hepsin Catalytic Chain) (MaxLight 650)
MBS6222632-02 5x 0.1 mL

HPN (TMPRSS1, Serine Protease Hepsin, Transmembrane Protease Serine 1, Serine Protease Hepsin Non-catalytic Chain, Serine Protease Hepsin Catalytic Chain) (MaxLight 650)

Sign In for Pricing
View Details
UBE2D1 siRNA (Rat)
orb1827974-01 15 nmol

UBE2D1 siRNA (Rat)

Sign In for Pricing
View Details
UBE2D1 siRNA (Rat)
orb1827974-02 30 nmol

UBE2D1 siRNA (Rat)

Sign In for Pricing
View Details