Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35E1 Rabbit Polyclonal Antibody (HRP)

SLC35E1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q96K37

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SLC35E1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTAILGVFLYNKTKYDANQQARKHLLPVTTADLSSKERHRSPLEKPHNGL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_079157

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENY2, NT (ENY2, Enhancer of yellow 2 transcription factor homolog) (MaxLight 405)
MBS6295814-01 0.1 mL

ENY2, NT (ENY2, Enhancer of yellow 2 transcription factor homolog) (MaxLight 405)

Sign In for Pricing
View Details
ENY2, NT (ENY2, Enhancer of yellow 2 transcription factor homolog) (MaxLight 405)
MBS6295814-02 5x 0.1 mL

ENY2, NT (ENY2, Enhancer of yellow 2 transcription factor homolog) (MaxLight 405)

Sign In for Pricing
View Details
RAB7B, CT (RAB7B, Ras-related protein Rab-7b) (Biotin)
MBS6339890-01 0.2 mL

RAB7B, CT (RAB7B, Ras-related protein Rab-7b) (Biotin)

Sign In for Pricing
View Details
RAB7B, CT (RAB7B, Ras-related protein Rab-7b) (Biotin)
MBS6339890-02 5x 0.2 mL

RAB7B, CT (RAB7B, Ras-related protein Rab-7b) (Biotin)

Sign In for Pricing
View Details
Mouse S100 Calcium Binding Protein A8 (S100A8) ELISA Kit-Sandwich
EK5F631-01 48 Test

Mouse S100 Calcium Binding Protein A8 (S100A8) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Mouse S100 Calcium Binding Protein A8 (S100A8) ELISA Kit-Sandwich
EK5F631-02 96 Tests

Mouse S100 Calcium Binding Protein A8 (S100A8) ELISA Kit-Sandwich

Sign In for Pricing
View Details