Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD53 Rabbit Polyclonal Antibody (FITC)

ANKRD53 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q8N9V6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ANKRD53

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RPASLTPPRADPSPSKESDQTAIDQTAIGSYYQLFAAAVGNVEWLRFCLN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_079209

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PT7-6xHis-PCIF1 Plasmid
PVT71578 2 µg

PT7-6xHis-PCIF1 Plasmid

Sign In for Pricing
View Details
NFYB, NT (NFYB, HAP3, Nuclear transcription factor Y subunit beta, CAAT box DNA-binding protein subunit B, Nuclear transcription factor Y subunit B) (Biotin)
MBS6325149-01 0.2 mL

NFYB, NT (NFYB, HAP3, Nuclear transcription factor Y subunit beta, CAAT box DNA-binding protein subunit B, Nuclear transcription factor Y subunit B) (Biotin)

Sign In for Pricing
View Details
NFYB, NT (NFYB, HAP3, Nuclear transcription factor Y subunit beta, CAAT box DNA-binding protein subunit B, Nuclear transcription factor Y subunit B) (Biotin)
MBS6325149-02 5x 0.2 mL

NFYB, NT (NFYB, HAP3, Nuclear transcription factor Y subunit beta, CAAT box DNA-binding protein subunit B, Nuclear transcription factor Y subunit B) (Biotin)

Sign In for Pricing
View Details
MTA2 Rabbit Polyclonal Antibody (APC-Cy7)
orb2376356 100 µL

MTA2 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Lentiviral mouse Slc25a39 shRNA (UAS) - Lentiviral mouse Slc25a39 shRNA (UAS) plasmid
GTR15258547 1 Vial

Lentiviral mouse Slc25a39 shRNA (UAS) - Lentiviral mouse Slc25a39 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Recombinant Borrelia andersonii DNA-binding protein HBbu (hbb)
MBS1404394-01 0.02 mg (E-Coli)

Recombinant Borrelia andersonii DNA-binding protein HBbu (hbb)

Sign In for Pricing
View Details