Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C5orf44 Rabbit Polyclonal Antibody (Biotin)

C5orf44 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SHLD3, C5orf44

UniProt

A5PLN9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human C5orf44

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: THILVCAVSYTTQAGEKMYFRKFFKFQVLKPLDVKTKFYNAESDLSSVTD

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079217

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carcinoembryonic Antigen (CEA) / CD66 (C66/1983R), Biotin conjugate, 0.1mg/mL
BNCB1983-100 1x 100 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/1983R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tshr Mouse Gene Knockout Kit (CRISPR)
KN518336 1 Kit

Tshr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Isopropyl Palmitate
TRC-I872715-1G 1 g

Isopropyl Palmitate

Sign In for Pricing
View Details
GJA1 Rabbit Polyclonal Antibody
AP02752PU-N 100 µL

GJA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human IgE,  15nm
GAF-005-15 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human IgE, 15nm

Sign In for Pricing
View Details
NMT2 Human Gene Knockout Kit (CRISPR)
KN402876 1 Kit

NMT2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details