Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C5orf44 Rabbit Polyclonal Antibody (HRP)

C5orf44 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SHLD3, C5orf44

UniProt

A5PLN9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human C5orf44

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: THILVCAVSYTTQAGEKMYFRKFFKFQVLKPLDVKTKFYNAESDLSSVTD

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079217

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMAP1 (NM_001281439) Human Tagged ORF Clone
RG238225 10 µg

SMAP1 (NM_001281439) Human Tagged ORF Clone

Sign In for Pricing
View Details
CD74 (BU45), CF740 conjugate, 0.1mg/mL
BNC740189-100 1x 100 µL

CD74 (BU45), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (31G7), CF740 conjugate, 0.1mg/mL
BNC741194-500 1x 500 µL

EGFR (31G7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Pancreas
CB630223 1 Block

Frozen Tissue Blocks, Pancreas

Sign In for Pricing
View Details
Human THNSL2 activation kit by CRISPRa
GA110651 1 Kit

Human THNSL2 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS716089 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details