Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDCP Rabbit Polyclonal Antibody (HRP)

WDCP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MMAP, PP384, C2orf44

UniProt

Q9H6R7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human C2orf44

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PPRLPQRKNLQSEKETYQLSKEVEILSRNLVEMQRCLSELTNRLHNGKKS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_079479

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Granulocyte Marker (BM-1), 0.2mg/mL
BNUB0061-500 1x 500 µL

Granulocyte Marker (BM-1), 0.2mg/mL

Sign In for Pricing
View Details
Retinol Binding Protein-1 (G4E4), Biotin conjugate, 0.1mg/mL
BNCB0855-100 1x 100 µL

Retinol Binding Protein-1 (G4E4), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Live-or-DyeTM 750/777 Fixable Viability Staining Kit (200 assays)
#32008 1 Kit

Live-or-DyeTM 750/777 Fixable Viability Staining Kit (200 assays)

Sign In for Pricing
View Details
Recombinant Human IL-25 protein (His Tag)
PKSH034110-01 20 µg

Recombinant Human IL-25 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human IL-25 protein (His Tag)
PKSH034110-02 100 µg

Recombinant Human IL-25 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse ST6GALNAC2 Protein (His Tag)
PKSM040489 50 µg

Recombinant Mouse ST6GALNAC2 Protein (His Tag)

Sign In for Pricing
View Details