Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGES3L-AARSD1 Rabbit Polyclonal Antibody (FITC)

PTGES3L-AARSD1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PTGES3L-AARSD1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ELYNEIEFYAKVNSKDSQDKRSSRSITCFVRKWKEKVAWPRLTKEDIKPV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001129514

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VASH2 (NM_001136475) Human Over-expression Lysate
LY427886 100 µg

VASH2 (NM_001136475) Human Over-expression Lysate

Sign In for Pricing
View Details
Pdgfra Mouse Gene Knockout Kit (CRISPR)
KN313036 1 Kit

Pdgfra Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Sema3f Mouse Gene Knockout Kit (CRISPR)
KN515498 1 Kit

Sema3f Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human RCSD 1 (RCSD1) activation kit by CRISPRa
GA114193 1 Kit

Human RCSD 1 (RCSD1) activation kit by CRISPRa

Sign In for Pricing
View Details
Fast Probe Master Mix, trial size (100 rxn)
#31005-T 1x 1 mL

Fast Probe Master Mix, trial size (100 rxn)

Sign In for Pricing
View Details
IRAKM (IRAK3) (NM_007199) Human Over-expression Lysate
LY402105 100 µg

IRAKM (IRAK3) (NM_007199) Human Over-expression Lysate

Sign In for Pricing
View Details