Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGES3L-AARSD1 Rabbit Polyclonal Antibody (FITC)

PTGES3L-AARSD1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PTGES3L-AARSD1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ELYNEIEFYAKVNSKDSQDKRSSRSITCFVRKWKEKVAWPRLTKEDIKPV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001129514

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLR1D Human Gene Knockout Kit (CRISPR)
KN401466 1 Kit

POLR1D Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human LRRC37A2 activation kit by CRISPRa
GA118566 1 Kit

Human LRRC37A2 activation kit by CRISPRa

Sign In for Pricing
View Details
CD33 (C33/69), CF740 conjugate, 0.1mg/mL
BNC740069-100 1x 100 µL

CD33 (C33/69), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GADD34 (PPP1R15A) Human Gene Knockout Kit (CRISPR)
KN200581RB 1 Kit

GADD34 (PPP1R15A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-Hydroxysulfosuccinimide Sodium Salt
TRC-H954000-1G 1 g

N-Hydroxysulfosuccinimide Sodium Salt

Sign In for Pricing
View Details
Human CENPT activation kit by CRISPRa
GA112840 1 Kit

Human CENPT activation kit by CRISPRa

Sign In for Pricing
View Details