Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCC1L Rabbit Polyclonal Antibody (FITC)

RCC1L Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

WBSCR16

UniProt

Q8IW88

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human WBSCR16

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GYGFTLLSSKTADVTKVWGMGLNKDSQLGFHRSRKDKTRGYEYVLEPSPV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

AAH40695

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APOA5 CRISPR Knock Out 293T Cell Line (Human)
12160141 1x 10^6 Cells / 1.0 mL

APOA5 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Rat Clathrin heavy chain 1 (CLTC) ELISA Kit
MBS7229056-01 48 Well

Rat Clathrin heavy chain 1 (CLTC) ELISA Kit

Sign In for Pricing
View Details
Rat Clathrin heavy chain 1 (CLTC) ELISA Kit
MBS7229056-02 96 Well

Rat Clathrin heavy chain 1 (CLTC) ELISA Kit

Sign In for Pricing
View Details
Rat Clathrin heavy chain 1 (CLTC) ELISA Kit
MBS7229056-03 5x 96 Well

Rat Clathrin heavy chain 1 (CLTC) ELISA Kit

Sign In for Pricing
View Details
Rat Clathrin heavy chain 1 (CLTC) ELISA Kit
MBS7229056-04 10x 96 Well

Rat Clathrin heavy chain 1 (CLTC) ELISA Kit

Sign In for Pricing
View Details
PACSIN1, NT (Protein Kinase C And Casein Kinase Substrate In Neurons Protein 1, KIAA1379) (MaxLight 405)
MBS6491663-01 0.1 mL

PACSIN1, NT (Protein Kinase C And Casein Kinase Substrate In Neurons Protein 1, KIAA1379) (MaxLight 405)

Sign In for Pricing
View Details