Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5V1 Rabbit Polyclonal Antibody (Biotin)

OR5V1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

6M1-21, hs6M1-21

UniProt

Q9UGF6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR5V1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VLSYICIISTILRIQSSEGRRKAFSTCASHLAIVFLFYGSAIFTYVRPIS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_110503

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMB6 (Proteasome Subunit beta Type-6, Y, LMPY, DELTA) (MaxLight 405)
MBS6433607-01 0.1 mL

PSMB6 (Proteasome Subunit beta Type-6, Y, LMPY, DELTA) (MaxLight 405)

Sign In for Pricing
View Details
PSMB6 (Proteasome Subunit beta Type-6, Y, LMPY, DELTA) (MaxLight 405)
MBS6433607-02 5x 0.1 mL

PSMB6 (Proteasome Subunit beta Type-6, Y, LMPY, DELTA) (MaxLight 405)

Sign In for Pricing
View Details
WHSC1 isoform3 (N) Antibody, Rabbit Polyclonal
orb67152 100 µL

WHSC1 isoform3 (N) Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to RalA Binding Protein 1 (RALBP1)
MBS2079465-01 0.1 mL

APC-Linked Polyclonal Antibody to RalA Binding Protein 1 (RALBP1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to RalA Binding Protein 1 (RALBP1)
MBS2079465-02 0.2 mL

APC-Linked Polyclonal Antibody to RalA Binding Protein 1 (RALBP1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to RalA Binding Protein 1 (RALBP1)
MBS2079465-03 0.5 mL

APC-Linked Polyclonal Antibody to RalA Binding Protein 1 (RALBP1)

Sign In for Pricing
View Details