Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5V1 Rabbit Polyclonal Antibody (HRP)

OR5V1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

6M1-21, hs6M1-21

UniProt

Q9UGF6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR5V1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VLSYICIISTILRIQSSEGRRKAFSTCASHLAIVFLFYGSAIFTYVRPIS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_110503

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pentachlorophenyl Laurate
TRC-P267015-1G 1 g

Pentachlorophenyl Laurate

Sign In for Pricing
View Details
Melanoma Marker (HMB45 + M2-7C10 + M2-9E3 + T311), CF488A conjugate, 0.1mg/mL
BNC880701-500 1x 500 µL

Melanoma Marker (HMB45 + M2-7C10 + M2-9E3 + T311), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-Maleimidopropionic Acid
TRC-M140750-5G 5 g

3-Maleimidopropionic Acid

Sign In for Pricing
View Details
Cytokeratin 8/18 (K8.8 + DC10), Biotin conjugate, 0.1mg/mL
BNCB0691-100 1x 100 µL

Cytokeratin 8/18 (K8.8 + DC10), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Helicobacter pylori (Rabbit PAb), CF488A conjugate, 0.1mg/mL
BNC880374-500 1x 500 µL

Helicobacter pylori (Rabbit PAb), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Edoxaban Tosylate Monohydrate
TRC-E555525-1G 1 g

Edoxaban Tosylate Monohydrate

Sign In for Pricing
View Details