Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C22orf13 Rabbit Polyclonal Antibody (FITC)

C22orf13 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LLN4, C22orf13

UniProt

Q96NT3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human C22orf13

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RHRFCTQTLGVDKGYKNQSFYRKHFDTEETRVNQLFAQAKACKVLVEKCT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_113632

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse DOS shRNA Plasmid
abx984336-01 150 µg

Mouse DOS shRNA Plasmid

Sign In for Pricing
View Details
Mouse DOS shRNA Plasmid
abx984336-02 300 µg

Mouse DOS shRNA Plasmid

Sign In for Pricing
View Details
West Nile Virus, Core, CT (WNV Core, Capsid Protein C) (MaxLight 490)
MBS6505999-01 0.1 mL

West Nile Virus, Core, CT (WNV Core, Capsid Protein C) (MaxLight 490)

Sign In for Pricing
View Details
West Nile Virus, Core, CT (WNV Core, Capsid Protein C) (MaxLight 490)
MBS6505999-02 5x 0.1 mL

West Nile Virus, Core, CT (WNV Core, Capsid Protein C) (MaxLight 490)

Sign In for Pricing
View Details
Cat Neutrophil Gelatinase-Associated Lipocalin (NGAL) ELISA Kit
MBS1602657-01 48 Well

Cat Neutrophil Gelatinase-Associated Lipocalin (NGAL) ELISA Kit

Sign In for Pricing
View Details
Cat Neutrophil Gelatinase-Associated Lipocalin (NGAL) ELISA Kit
MBS1602657-02 96 Well

Cat Neutrophil Gelatinase-Associated Lipocalin (NGAL) ELISA Kit

Sign In for Pricing
View Details