Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C22orf13 Rabbit Polyclonal Antibody (FITC)

C22orf13 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LLN4, C22orf13

UniProt

Q96NT3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human C22orf13

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RHRFCTQTLGVDKGYKNQSFYRKHFDTEETRVNQLFAQAKACKVLVEKCT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_113632

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAT Protein (N-His, Human)
P505555 100 µg

LAT Protein (N-His, Human)

Sign In for Pricing
View Details
RNU6-25 CRISPR All-in-one AAV vector set (with saCas9)(Human)
40446151 3x 1.0 µg DNA

RNU6-25 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Human TP73/Tumor protein p73 ELISA Kit
MBS2903827-01 48 Well

Human TP73/Tumor protein p73 ELISA Kit

Sign In for Pricing
View Details
Human TP73/Tumor protein p73 ELISA Kit
MBS2903827-02 96 Well

Human TP73/Tumor protein p73 ELISA Kit

Sign In for Pricing
View Details
Human TP73/Tumor protein p73 ELISA Kit
MBS2903827-03 5x 96 Well

Human TP73/Tumor protein p73 ELISA Kit

Sign In for Pricing
View Details
Human TP73/Tumor protein p73 ELISA Kit
MBS2903827-04 10x 96 Well

Human TP73/Tumor protein p73 ELISA Kit

Sign In for Pricing
View Details