Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C22orf13 Rabbit Polyclonal Antibody (HRP)

C22orf13 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LLN4, C22orf13

UniProt

Q96NT3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human C22orf13

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RHRFCTQTLGVDKGYKNQSFYRKHFDTEETRVNQLFAQAKACKVLVEKCT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_113632

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Anti Integrin alphaVbeta6 Antibody IgG ELISA Kit
MBS7280118-01 48 Well

Porcine Anti Integrin alphaVbeta6 Antibody IgG ELISA Kit

Sign In for Pricing
View Details
Porcine Anti Integrin alphaVbeta6 Antibody IgG ELISA Kit
MBS7280118-02 96 Well

Porcine Anti Integrin alphaVbeta6 Antibody IgG ELISA Kit

Sign In for Pricing
View Details
Porcine Anti Integrin alphaVbeta6 Antibody IgG ELISA Kit
MBS7280118-03 5x 96 Well

Porcine Anti Integrin alphaVbeta6 Antibody IgG ELISA Kit

Sign In for Pricing
View Details
Porcine Anti Integrin alphaVbeta6 Antibody IgG ELISA Kit
MBS7280118-04 10x 96 Well

Porcine Anti Integrin alphaVbeta6 Antibody IgG ELISA Kit

Sign In for Pricing
View Details
Peptide YY Lentiviral Activation Particles (m2)
sc-432184-LAC-2 200 µL

Peptide YY Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
ENPP7 (ABCDS, Ednra, EDNRB, EDNRB_HUMAN, Endothelin B Receptor, Endothelin B Receptor Precursor, Endothelin Receptor Non selective Type, Endothelin Receptor non-selective Type, Endothelin Receptor Type B, ET B, ET-B, ET-BR, ETB, ETBR, ETRB, Hirschsprung Disease 2, HSCR, HSCR2, OTTHUMP00000018534, OTTHUMP00000178736, WS4A, ) discontinued
222431-01 50 µL

ENPP7 (ABCDS, Ednra, EDNRB, EDNRB_HUMAN, Endothelin B Receptor, Endothelin B Receptor Precursor, Endothelin Receptor Non selective Type, Endothelin Receptor non-selective Type, Endothelin Receptor Type B, ET B, ET-B, ET-BR, ETB, ETBR, ETRB, Hirschsprung Disease 2, HSCR, HSCR2, OTTHUMP00000018534, OTTHUMP00000178736, WS4A, ) discontinued

Sign In for Pricing
View Details