Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPRTN Rabbit Polyclonal Antibody (Biotin)

SPRTN Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DVC1, PRO4323, spartan, C1orf124

UniProt

Q9H040

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SPRTN

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ATNREPSAHDYWWAEHQKTCGGTYIKIKEPENYSKKGKGKAKLGKEPVLA

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_114407

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFX3 Blocking Peptide
MBS9619678-01 1 mg

RFX3 Blocking Peptide

Sign In for Pricing
View Details
RFX3 Blocking Peptide
MBS9619678-02 5x 1 mg

RFX3 Blocking Peptide

Sign In for Pricing
View Details
ATG12, NT (APG12, APG12L, HAPG12, APG12 Autophagy 12-like, APG12-like, Apg12 (Autophagy, yeast) Homolog, Autophagy-related Protein 12) (MaxLight 490) discontinued
A2298-76N-ML490 100 µL

ATG12, NT (APG12, APG12L, HAPG12, APG12 Autophagy 12-like, APG12-like, Apg12 (Autophagy, yeast) Homolog, Autophagy-related Protein 12) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Lentiviral human BHMT2 sgRNA gene knockout kit - Lentiviral human BHMT2 sgRNA gene knockout kit (100)
GTR15392365 1 Vial

Lentiviral human BHMT2 sgRNA gene knockout kit - Lentiviral human BHMT2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
MPZL2 Blocking Peptide
33R-4881 100 ug

MPZL2 Blocking Peptide

Sign In for Pricing
View Details
mmu-miR-346 miRNA Antagomir
MNM01914 2x 5.0 nmol

mmu-miR-346 miRNA Antagomir

Sign In for Pricing
View Details