Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR75 Rabbit Polyclonal Antibody (HRP)

WDR75 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NET16, UTP17

UniProt

Q8IWA0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human WDR75

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LVSVKLPKSSSQEVEAKELSFVLDYINQSPKCIAFGNEGVYVAAVREFYL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_115544

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ndst2 ORF Vector (Mouse) (pORF)
ORF051143 1.0 µg DNA

Ndst2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
KLF2 (Kruppel-like Factor 2, Lung Kruppel-like Factor, LKLF, Lung Kruppel-like Zinc Finger Transcription Factor, Kruppel-like Factor LKLF) (MaxLight 650)
MBS6222895-01 0.1 mL

KLF2 (Kruppel-like Factor 2, Lung Kruppel-like Factor, LKLF, Lung Kruppel-like Zinc Finger Transcription Factor, Kruppel-like Factor LKLF) (MaxLight 650)

Sign In for Pricing
View Details
KLF2 (Kruppel-like Factor 2, Lung Kruppel-like Factor, LKLF, Lung Kruppel-like Zinc Finger Transcription Factor, Kruppel-like Factor LKLF) (MaxLight 650)
MBS6222895-02 5x 0.1 mL

KLF2 (Kruppel-like Factor 2, Lung Kruppel-like Factor, LKLF, Lung Kruppel-like Zinc Finger Transcription Factor, Kruppel-like Factor LKLF) (MaxLight 650)

Sign In for Pricing
View Details
Mouse Phorbol-12-myristate-13-acetate-induced protein 1, PMAIP1 ELISA Kit
MBS9321693-01 48 Well

Mouse Phorbol-12-myristate-13-acetate-induced protein 1, PMAIP1 ELISA Kit

Sign In for Pricing
View Details
Mouse Phorbol-12-myristate-13-acetate-induced protein 1, PMAIP1 ELISA Kit
MBS9321693-02 96 Well

Mouse Phorbol-12-myristate-13-acetate-induced protein 1, PMAIP1 ELISA Kit

Sign In for Pricing
View Details
Mouse Phorbol-12-myristate-13-acetate-induced protein 1, PMAIP1 ELISA Kit
MBS9321693-03 5x 96 Well

Mouse Phorbol-12-myristate-13-acetate-induced protein 1, PMAIP1 ELISA Kit

Sign In for Pricing
View Details