Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR75 Rabbit Polyclonal Antibody (HRP)

WDR75 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NET16, UTP17

UniProt

Q8IWA0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human WDR75

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LVSVKLPKSSSQEVEAKELSFVLDYINQSPKCIAFGNEGVYVAAVREFYL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_115544

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIP2 Antibody Blocking peptide
orb1451122 500 µg

HIP2 Antibody Blocking peptide

Sign In for Pricing
View Details
Tubulin, alpha (Alpha Tubulin, Tubulin alpha Ubiquitous, H2-Alpha, K-alpha-1, TUBA3, Tubulin alpha 1 Chain, TUBA1, TUBA1A, Tubulin K alpha 1) (Biotin)
MBS6258430-01 0.1 mL

Tubulin, alpha (Alpha Tubulin, Tubulin alpha Ubiquitous, H2-Alpha, K-alpha-1, TUBA3, Tubulin alpha 1 Chain, TUBA1, TUBA1A, Tubulin K alpha 1) (Biotin)

Sign In for Pricing
View Details
Tubulin, alpha (Alpha Tubulin, Tubulin alpha Ubiquitous, H2-Alpha, K-alpha-1, TUBA3, Tubulin alpha 1 Chain, TUBA1, TUBA1A, Tubulin K alpha 1) (Biotin)
MBS6258430-02 5x 0.1 mL

Tubulin, alpha (Alpha Tubulin, Tubulin alpha Ubiquitous, H2-Alpha, K-alpha-1, TUBA3, Tubulin alpha 1 Chain, TUBA1, TUBA1A, Tubulin K alpha 1) (Biotin)

Sign In for Pricing
View Details
Anti-Human CD131/CSF2RB Monoclonal Antibody (ABS1483), FITC
PTX21937 100 µg

Anti-Human CD131/CSF2RB Monoclonal Antibody (ABS1483), FITC

Sign In for Pricing
View Details
ARL3 (ADP-Ribosylation Factor-like 3, ARFL3)
243480 50 µg

ARL3 (ADP-Ribosylation Factor-like 3, ARFL3)

Sign In for Pricing
View Details
Phospho-eIF4G (Ser1185) Antibody
MBS9610712-01 0.05 mL

Phospho-eIF4G (Ser1185) Antibody

Sign In for Pricing
View Details