Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis variant africanum PE family protein PE13 (PE13)

Product Specifications

Abbreviation

Recombinant Mycobacterium tuberculosis variant africanum PE13 protein

Gene Name

PE13

UniProt

A0A120J0I3

Expression Region

1-101aa

Organism

Mycobacterium tuberculosis variant africanum

Target Sequence

MHVSFVMAYPEMLAAAADTLQSIGATTVASNAAAAAPTTGVVPPAADEVSALTAAHFAAHAAMYQSVSARAAAIHDQFVATLASSASSYAATEVANAAAAS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCL4 (LAG1, MIP1B, SCYA4, C-C Motif Chemokine 4, G-26 T-lymphocyte-secreted Protein, HC21, Lymphocyte Activation Gene 1 Protein, Macrophage Inflammatory Protein 1-beta, PAT 744, Protein H400, SIS-gamma, Small-inducible Cytokine A4, T-cell Activation Protein 2, MIP-1-beta (1-69), MGC104418, MGC126025, MGC126026) (APC)
124468-APC 100 µL

CCL4 (LAG1, MIP1B, SCYA4, C-C Motif Chemokine 4, G-26 T-lymphocyte-secreted Protein, HC21, Lymphocyte Activation Gene 1 Protein, Macrophage Inflammatory Protein 1-beta, PAT 744, Protein H400, SIS-gamma, Small-inducible Cytokine A4, T-cell Activation Protein 2, MIP-1-beta (1-69), MGC104418, MGC126025, MGC126026) (APC)

Sign In for Pricing
View Details
Ret (NM_009050) Mouse Tagged Lenti ORF Clone
MR226724L3 10 µg

Ret (NM_009050) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Rat PIINP
Pr10124-01 50 µg

Recombinant Rat PIINP

Sign In for Pricing
View Details
Recombinant Rat PIINP
Pr10124-02 200 µg

Recombinant Rat PIINP

Sign In for Pricing
View Details
Recombinant Rat PIINP
Pr10124-03 1 mg

Recombinant Rat PIINP

Sign In for Pricing
View Details
Rabbit Monoclonal C1D Antibody (042) [HRP]
NBP2-90104H 0.1 mL

Rabbit Monoclonal C1D Antibody (042) [HRP]

Sign In for Pricing
View Details