Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOPT1 Rabbit Polyclonal Antibody (Biotin)

APOPT1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

APOP, APOP1, APOPT1, MC4DN17, C14orf153

UniProt

Q96IL0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human APOPT1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KEFLSKNFQKHMYYNRDWYKRNFAITFFMGKVALERIWNKLKQKQKKRSN

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_115750

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SALL4 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2536736 100 µL

SALL4 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
ZNF25, NT (ZNF25, KOX19, Zinc finger protein 25, Zinc finger protein KOX19) (Biotin)
MBS6365977-01 0.2 mL

ZNF25, NT (ZNF25, KOX19, Zinc finger protein 25, Zinc finger protein KOX19) (Biotin)

Sign In for Pricing
View Details
ZNF25, NT (ZNF25, KOX19, Zinc finger protein 25, Zinc finger protein KOX19) (Biotin)
MBS6365977-02 5x 0.2 mL

ZNF25, NT (ZNF25, KOX19, Zinc finger protein 25, Zinc finger protein KOX19) (Biotin)

Sign In for Pricing
View Details
SF3B4 Human shRNA Plasmid Kit (Locus ID 10262)
TL309505 1 Kit

SF3B4 Human shRNA Plasmid Kit (Locus ID 10262)

Sign In for Pricing
View Details
KREMEN2 Polyclonal Antibody
MBS8570877-01 0.1 mL

KREMEN2 Polyclonal Antibody

Sign In for Pricing
View Details
KREMEN2 Polyclonal Antibody
MBS8570877-02 0.1 mL (AF405L)

KREMEN2 Polyclonal Antibody

Sign In for Pricing
View Details