Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GON7 Rabbit Polyclonal Antibody (HRP)

GON7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PNAS-127, C14orf142

UniProt

Q9BXV9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human C14orf142

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LVQGEVQHRVAAAPDEDLDGDDEDDAEDENNIDNRTNFDGPSAKRPKTPS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_115879

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transcription Factor 4, T-cell Specific, HMG-box (TF4, TF7L2, Transcription Factor 7-like 2) (AP) discontinued
T8195-35A-AP 100 µL

Transcription Factor 4, T-cell Specific, HMG-box (TF4, TF7L2, Transcription Factor 7-like 2) (AP) discontinued

Sign In for Pricing
View Details
Chicken anti-Mouse IgG (H&L) - Affinity Pure, min x w/human or rabbit IgG/serum proteins
MBS687408-01 0.5 mg

Chicken anti-Mouse IgG (H&L) - Affinity Pure, min x w/human or rabbit IgG/serum proteins

Sign In for Pricing
View Details
Chicken anti-Mouse IgG (H&L) - Affinity Pure, min x w/human or rabbit IgG/serum proteins
MBS687408-02 5x 0.5 mg

Chicken anti-Mouse IgG (H&L) - Affinity Pure, min x w/human or rabbit IgG/serum proteins

Sign In for Pricing
View Details
LIPA Protein Vector (Rat) (pPB-N-His)
PV277663 500 ng

LIPA Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Anti-Human PARP14 IP Antibody
MBS1568676-01 0.1 mg

Anti-Human PARP14 IP Antibody

Sign In for Pricing
View Details
Anti-Human PARP14 IP Antibody
MBS1568676-02 1 mg

Anti-Human PARP14 IP Antibody

Sign In for Pricing
View Details