Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C22orf23 Rabbit Polyclonal Antibody (Biotin)

C22orf23 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EVG1, dJ1039K5.6

UniProt

Q9BZE7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human C22orf23

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ILAARPHLRPANMCQANGAYSREQFKPQATRDLEKEKQRLQNIFATGKDM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115950

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRIP2 HDR Plasmid (h)
sc-408970-HDR 20 µg

GRIP2 HDR Plasmid (h)

Sign In for Pricing
View Details
P2RY4 Protein Lysate (Rat) with C-HA Tag
35872036 100 µg

P2RY4 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
PAX6, Control Peptide (AN2, Paired Box Protein Pax-6, Aniridia Type II Protein, Oculorhombin, MGC17209, D11S812E)
148300 100 µg

PAX6, Control Peptide (AN2, Paired Box Protein Pax-6, Aniridia Type II Protein, Oculorhombin, MGC17209, D11S812E)

Sign In for Pricing
View Details
Rabbit Polyclonal SLC45A3/Prostein Antibody [Biotin]
NB200-129B 0.1 mL

Rabbit Polyclonal SLC45A3/Prostein Antibody [Biotin]

Sign In for Pricing
View Details
Goat Polyclonal ENPP-1 Antibody [Alexa Fluor 405]
NB600-816AF405 0.1 mL

Goat Polyclonal ENPP-1 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
VWDE Human siRNA Oligo Duplex (Locus ID 221806)
SR316638 1 Kit

VWDE Human siRNA Oligo Duplex (Locus ID 221806)

Sign In for Pricing
View Details