Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C22orf23 Rabbit Polyclonal Antibody (FITC)

C22orf23 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EVG1, dJ1039K5.6

UniProt

Q9BZE7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human C22orf23

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ILAARPHLRPANMCQANGAYSREQFKPQATRDLEKEKQRLQNIFATGKDM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115950

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EP400 (E1A-binding Protein p400, CAG Repeat Protein 32, Domino Homolog, hDomino, Trinucleotide Repeat-containing Gene 12 Protein, p400kD SWI2/SNF2-related Protein, CAGH32, KIAA1498, KIAA1818, TNRC12, DKFZP434I225, FLJ42018, FLJ45115, P400) (FITC)
126357-FITC 100 µL

EP400 (E1A-binding Protein p400, CAG Repeat Protein 32, Domino Homolog, hDomino, Trinucleotide Repeat-containing Gene 12 Protein, p400kD SWI2/SNF2-related Protein, CAGH32, KIAA1498, KIAA1818, TNRC12, DKFZP434I225, FLJ42018, FLJ45115, P400) (FITC)

Sign In for Pricing
View Details
Gamma Tubulin mouse Monoclonal Antibody(7B1)
JOT-MCA0588-01 20 µL

Gamma Tubulin mouse Monoclonal Antibody(7B1)

Sign In for Pricing
View Details
Gamma Tubulin mouse Monoclonal Antibody(7B1)
JOT-MCA0588-02 50 μL

Gamma Tubulin mouse Monoclonal Antibody(7B1)

Sign In for Pricing
View Details
Gamma Tubulin mouse Monoclonal Antibody(7B1)
JOT-MCA0588-03 100 µL

Gamma Tubulin mouse Monoclonal Antibody(7B1)

Sign In for Pricing
View Details
Recombinant Human CD300d/CD300LD Protein, C-Fc
E55P6277 50 µg

Recombinant Human CD300d/CD300LD Protein, C-Fc

Sign In for Pricing
View Details
Rat Pard3b Pre-designed siRNA Set B
SI210058B 1 Each

Rat Pard3b Pre-designed siRNA Set B

Sign In for Pricing
View Details