Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C22orf23 Rabbit Polyclonal Antibody (HRP)

C22orf23 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EVG1, dJ1039K5.6

UniProt

Q9BZE7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human C22orf23

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ILAARPHLRPANMCQANGAYSREQFKPQATRDLEKEKQRLQNIFATGKDM

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115950

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC146701 Human qPCR Primer Pair (XM_097065)
HP221081 200 Reactions

LOC146701 Human qPCR Primer Pair (XM_097065)

Sign In for Pricing
View Details
2,4-Dinitrophenol (wetted with water >15%)
TRC-D479945-25G 25 g

2,4-Dinitrophenol (wetted with water >15%)

Sign In for Pricing
View Details
Human ZHX1-C8orf76 activation kit by CRISPRa
GA119378 1 Kit

Human ZHX1-C8orf76 activation kit by CRISPRa

Sign In for Pricing
View Details
C11orf20 (TEX40) (NM_001039496) Human Recombinant Protein
TP320639M 100 µg

C11orf20 (TEX40) (NM_001039496) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Cav3 activation kit by CRISPRa
GA200552 1 Kit

Mouse Cav3 activation kit by CRISPRa

Sign In for Pricing
View Details
Urine Exfoliated Cell and Bacteria RNA Purification Kit
22550 25 Preparations

Urine Exfoliated Cell and Bacteria RNA Purification Kit

Sign In for Pricing
View Details